CAT# | HB00168 |
M.W/Mr. | 4715.3 |
Sequence | Three-Letter Code: H-Trp-Met-Glu-Trp-Asp-Arg-Glu-Ile-Asn-Asn-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Lys (LC-BIOTIN)-NH2 One-Letter Code: WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL |
Storage | -20 ± 5 °C |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
HB00160 | HIV (gp120) Fragment (308-331) | Inquiry | ||
HB00159 | HIV-1 env Protein gp120 (278-292) (strains BH10, BH8, HXB2, HXB3, PV22) | Inquiry | ||
HB00165 | HIV (gp120) Antigenic Peptide trifluoroacetate salt | Inquiry | ||
H09874 | C34 gp41 HIV Fragment | Inquiry | ||
HB00164 | HIV-1 gag Polyprotein (121-140) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...
Tertiapin-Q (TPN-Q) is a small compact protein that contains twenty-one amino acids, which derived from bee veno ...
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...