Keywords Search Google Search Search

C34 - LC - Biotin, gp41 HIV fragment

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	HB00168
M.W/Mr.	4715.3
Sequence	Three-Letter Code: H-Trp-Met-Glu-Trp-Asp-Arg-Glu-Ile-Asn-Asn-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Lys (LC-BIOTIN)-NH2 One-Letter Code: WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL

CAT#	Product Name	Inquiry
H09874	C34 gp41 HIV Fragment	Inquiry
HB00159	HIV-1 env Protein gp120 (278-292) (strains BH10, BH8, HXB2, HXB3, PV22)	Inquiry
HB00165	HIV (gp120) Antigenic Peptide trifluoroacetate salt	Inquiry
HB00164	HIV-1 gag Polyprotein (121-140)	Inquiry
HB00163	HIV (gp120) Fragment (318-327)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of leuprolide acetate in disorders of the reproductive system

Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...

Function of Abarelix in Advanced Prostate Cancer

Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...

The efficacy of teicoplanin in the treatment of Gram-positive cocci infection

Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...

C 21, a selective protein arginine methyltransferase 1 inhibitor

C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...

What is Glutathione?

Glutathione (γ-Glu-Cys-Gly, GSH) is the most abundant antioxidant in animal tissues, at 0.1-10 mM, as well as i ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: