C34 - LC - Biotin, gp41 HIV fragment

C34-LC-Biotin, gp41 HIV fragment fuses the C34 heptad-repeat peptide from gp41 with a linker and biotin tag. The construct preserves the α-helical coiled-coil motif critical for fusion-core studies. Its labeled format enables immobilization and complex capture. Researchers use it in fusion-mechanism analysis, binding assays, and structural modeling of gp41 interactions.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: HB00168

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
4715.3
Sequence
Three-Letter Code: H-Trp-Met-Glu-Trp-Asp-Arg-Glu-Ile-Asn-Asn-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Lys (LC-BIOTIN)-NH2
One-Letter Code: WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesEpitope Mapping ServicesPeptide Synthesis ServicesPeptide Analysis ServicesPeptide Nucleic Acids SynthesisPeptide CDMOcGMP Peptide ServiceCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers