Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3371.9 |
Sequence | CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 |
Length | 32 |
Modifications | disulfide |
1. Cationic cell-penetrating peptides are potent furin inhibitors
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.