CAT# | C06006 |
M.W/Mr. | 3371.9 |
Sequence | CASLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 |
Length | 32 | Modifications | disulfide |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C06007 | Calcitonin, rat | Inquiry | ||
C06012 | Calcitonin, porcine | Inquiry | ||
C06011 | Glu20-salmon calcitonin | Inquiry | ||
C06001 | Calcitonin C-terminal Adjacent Peptide, rat | Inquiry | ||
C06008 | Calcitonin, eel | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Eptifibatide acetate is a white or white-off powder, soluble in water and freely soluble in 1% acetic in water, ...
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...