CAT# | AF2171 |
Sequence | WNSNRRFRVGRPPVVGRPGCVCFRAPCPCSNY |
Activity | Antibacterial |
Host Chemicals | Callinectes sapidus | Length | 32 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF169 | Temporin-CG2 | Inquiry | ||
AF1383 | Latarcin-4b | Inquiry | ||
AF596 | Citropin-1.1.3 | Inquiry | ||
AF1525 | Halibut Hb18 | Inquiry | ||
AF077 | HaA4 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Tertiapin-Q (TPN-Q) is a small compact protein that contains twenty-one amino acids, which derived from bee veno ...
The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...
PR 39, a porcine 39-aa peptide antibiotic, was originally isolated from the upper part of the small intestine o ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...