CAT# | AF3336 |
Sequence | LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIAKQGIKKAIQL |
Activity | Gram+, |
Host Chemicals | Carnobacterium maltaromaticum UAL307 | Length | 60 | SwissProt ID | PDB ID: 2KJF |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF662 | Corticostatin-related peptide LCRP | Inquiry | ||
AF1482 | Spinigerin | Inquiry | ||
AF1761 | Odorranain-F1 antimicrobial peptide | Inquiry | ||
AF3224 | PsD2 | Inquiry | ||
AF2115 | Brevinin-2CG1 antimicrobial peptide precursor | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Catestain, a 21 amino acid fragment of chromogranin A (CgA), is divided into human CgA352-372 and bovine CgA344- ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...