Keywords Search Google Search Search

Cathelicidin antimicrobial peptide precursor

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2948
Sequence	LRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF1177	Brevinin-1SN1 antimicrobial peptide precursor	Inquiry
AF1473	XPF-St6	Inquiry
AF935	Nigrocin-2JDa	Inquiry
AF2826	Beta-defensin 5 , BNBD-5	Inquiry
AF2855	Beta-defensin 5 precursor	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Comprehensive effect of angiotensin II acetate

Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...

Enhanced Binding and Antagonism of Camstatin

Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...

Function of ecallantide in hereditary angioedema

Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...

The effect of thymopentin in the treatment of chronic severe viral hepatitis B

The thymopentin is a small peptide consisting of 5 amino acid residues (Arg-Lys-Asp-Val-Tyr) from thymosin. It h ...

Effects of tripeptide-3 in skin

Neurotransmitter Inhibitor Peptides Peptides used in topical anti-aging products have multiple applications. Gorouhi and Maib ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Cavia porcellus
Length	42
SwissProt ID	Q91X12