CAT# | AF2948 |
Sequence | LRKKFRKTRKRIQKLGRKIGKTGRKVWKAWREYGQIPYPCRI |
Activity | Antibacterial |
Host Chemicals | Cavia porcellus | Length | 42 | SwissProt ID | Q91X12 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2277 | Beta-defensin 5 antimicrobial peptide, partial | Inquiry | ||
AF2486 | RhBD-1 | Inquiry | ||
AF623 | Temporin-1Sd precursor, partial | Inquiry | ||
AF3115 | Cysteine-rich antifungal protein 1 (Bn-AFP1) | Inquiry | ||
AF1133 | Plasticin-C1 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...
Eptifibatide acetate is a white or white-off powder, soluble in water and freely soluble in 1% acetic in water, ...
Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...