CC Chemokine Receptor 3 Fragment I, amide

CC Chemokine Receptor 3 Fragment I, amide corresponds to a short region implicated in receptor-structural studies. The peptide's charged and hydrophobic residues contribute to conformational states relevant to receptor-binding models. Its amidated C-terminus stabilizes solution structure. Applications include structural mapping, binding-interface analysis, and motif-function evaluation.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: S06011

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt
M.W/Mr.
3332.6
Sequence
MTTSLDTVETFGTTSYYDDVGLLCEKADTR-NH2
Length
30

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisPeptide Synthesis ServicesPeptide CDMOcGMP Peptide ServicePeptide Analysis ServicesPeptide Modification ServicesEpitope Mapping ServicesCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers