CAT# | S06011 |
M.F/Formula | Each vial contains lyophilized solid packaged under an inert gas and supplied as a trifluoroacetate salt |
M.W/Mr. | 3332.6 |
Sequence | MTTSLDTVETFGTTSYYDDVGLLCEKADTR-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
Topotecan (TPT) is a water-soluble, semi-synthetic camptothecin derivative developed by Smithkline Beecham, USA. ...
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...