Cecropin A

Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Cecropin A(CAS 80451-04-3)

CAT No: R1273

CAS No:80451-04-3

Synonyms/Alias:Cecropin A;80451-04-3;P9A Protein;dsim protein, Drosophila;dyak protein, Drosophila;cecA1 protein, Drosophila;cecA2 protein, Drosophila;cecropin A2 protein, Drosphila;cecropin A1 protein, Drosophila;DTXSID30230333;Cecropin A (trifluoroacetate salt);CHEMBL3942653;DTXCID30152824;DA-62170;FC108878;G12335;KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2;Cecropin A (1-33), DTXSID80231193, 81541-05-1;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C184H313N53O46
M.W/Mr.
4004
Sequence
One Letter Code:KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK
Three Letter Code:H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2

Cecropin A is a naturally occurring antimicrobial peptide originally isolated from the hemolymph of the cecropia moth, and it is recognized for its potent activity against a broad spectrum of bacteria. As a member of the cecropin family, this linear, amphipathic peptide is characterized by its ability to disrupt microbial membranes, making it a valuable tool in the study of innate immune mechanisms. Its unique structural features, including a helical conformation and cationic nature, contribute to its selective interaction with microbial cell membranes, sparing most eukaryotic cells. Cecropin A has become an important resource in biochemical research due to its relevance in host defense, membrane biology, and peptide-based antimicrobial strategies.

Antimicrobial mechanism studies: Cecropin A serves as a model system for investigating the mechanisms of peptide-mediated microbial inhibition. Researchers utilize it to elucidate the molecular basis of membrane permeabilization, pore formation, and bacterial lysis. Its well-characterized sequence and robust activity profile provide a reliable framework for dissecting the physicochemical interactions between cationic peptides and lipid bilayers, advancing understanding of natural antimicrobial defenses.

Peptide engineering and design: The peptide is frequently employed in the rational design and optimization of novel antimicrobial agents. By analyzing the structure-activity relationships of Cecropin A, scientists can identify key residues responsible for activity and specificity, guiding the development of synthetic analogs with enhanced stability, spectrum, or reduced cytotoxicity. Its use in peptide engineering supports the creation of next-generation bioactive peptides for research applications.

Membrane biophysics research: Due to its defined helical structure and membrane-active properties, Cecropin A is a valuable probe in studies of lipid bilayer dynamics and peptide-membrane interactions. Experimental systems incorporating model membranes or liposomes allow for detailed analysis of peptide insertion, orientation, and aggregation. Such research provides insights into fundamental biophysical processes relevant to both antimicrobial function and membrane protein behavior.

Innate immunity modeling: The peptide is instrumental in modeling innate immune responses across various organisms. By introducing Cecropin A into in vitro or ex vivo systems, scientists can investigate the modulation of immune signaling pathways, assess the induction of secondary defense mechanisms, and explore evolutionary aspects of peptide-based immunity. Its conserved action across diverse species makes it a reference point for comparative immunology studies.

Peptide synthesis validation: Cecropin A is commonly used as a benchmark in peptide synthesis and purification protocols. Its established sequence and functional properties make it an ideal standard for optimizing solid-phase peptide synthesis, verifying chromatographic separation methods, and calibrating analytical instrumentation. Employing this peptide in methodological development ensures reliable performance and reproducibility in peptide chemistry workflows.

Length
37
InChI
InChI=1S/C184H313N53O46/c1-27-98(16)145(182(282)235-149(102(20)31-5)181(281)218-115(59-39-46-76-187)159(259)206-103(21)152(252)205-92-138(246)237-82-52-65-130(237)173(273)208-106(24)154(254)228-143(96(12)13)176(276)209-107(25)155(255)229-144(97(14)15)177(277)231-142(95(10)11)175(275)204-89-135(243)211-121(66-70-131(193)239)160(260)207-105(23)156(256)236-150(108(26)238)183(283)221-123(68-72-133(195)241)168(268)232-146(99(17)28-2)178(278)210-104(22)153(253)213-114(151(197)251)58-38-45-75-186)227-137(245)91-202-158(258)129(87-140(249)250)226-163(263)120(64-51-81-200-184(198)199)219-179(279)148(101(19)30-4)234-172(272)128(86-134(196)242)225-164(264)122(67-71-132(194)240)212-136(244)90-203-174(274)141(94(8)9)230-166(266)118(62-42-49-79-190)215-165(265)124(69-73-139(247)248)220-180(280)147(100(18)29-3)233-167(267)119(63-43-50-80-191)214-161(261)116(60-40-47-77-188)216-170(270)126(84-109-53-33-32-34-54-109)224-169(269)125(83-93(6)7)223-162(262)117(61-41-48-78-189)217-171(271)127(222-157(257)112(192)56-37-44-74-185)85-110-88-201-113-57-36-35-55-111(110)113/h32-36,53-55,57,88,93-108,112,114-130,141-150,201,238H,27-31,37-52,56,58-87,89-92,185-192H2,1-26H3,(H2,193,239)(H2,194,240)(H2,195,241)(H2,196,242)(H2,197,251)(H,202,258)(H,203,274)(H,204,275)(H,205,252)(H,206,259)(H,207,260)(H,208,273)(H,209,276)(H,210,278)(H,211,243)(H,212,244)(H,213,253)(H,214,261)(H,215,265)(H,216,270)(H,217,271)(H,218,281)(H,219,279)(H,220,280)(H,221,283)(H,222,257)(H,223,262)(H,224,269)(H,225,264)(H,226,263)(H,227,245)(H,228,254)(H,229,255)(H,230,266)(H,231,277)(H,232,268)(H,233,267)(H,234,272)(H,235,282)(H,236,256)(H,247,248)(H,249,250)(H4,198,199,200)/t98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108+,112-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-/m0/s1
InChI Key
HCQPHKMLKXOJSR-IRCPFGJUSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServiceEpitope Mapping ServicesPeptide CDMOPeptide Modification ServicesPeptide Analysis ServicescGMP Peptide ServicePeptide Synthesis ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers