Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity.
CAT No: R1273
CAS No:80451-04-3
Synonyms/Alias:Cecropin A;80451-04-3;P9A Protein;dsim protein, Drosophila;dyak protein, Drosophila;cecA1 protein, Drosophila;cecA2 protein, Drosophila;cecropin A2 protein, Drosphila;cecropin A1 protein, Drosophila;DTXSID30230333;Cecropin A (trifluoroacetate salt);CHEMBL3942653;DTXCID30152824;DA-62170;FC108878;G12335;KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2;Cecropin A (1-33), DTXSID80231193, 81541-05-1;
1. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
4. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.