Chlorotoxin(linear)

Chlorotoxin(linear) is a linear 36 amino-acid peptide which can be used in Chlorotoxin related research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1291

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₅₈H₂₅₆N₅₂O₄₈S₁₁
M.W/Mr.
4004.76
Sequence
One Letter Code: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2
three Letter Code: Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2

Chlorotoxin (linear) is a synthetic peptide originally derived from the venom of the deathstalker scorpion, known for its highly selective binding to specific chloride channels and matrix metalloproteinase-2 (MMP-2) isoforms. As a linear analog, it retains the core amino acid sequence of native chlorotoxin but lacks the native disulfide-bridged conformation, providing researchers with a valuable tool for dissecting structure-activity relationships and functional properties. Its unique interaction with cellular ion channels and extracellular matrix components has made it a prominent subject in neurobiology, cancer biology, and ion channel research. The linear form is particularly useful for studies aiming to distinguish the roles of peptide folding and disulfide connectivity in biological activity, offering insight into the molecular determinants of target specificity and binding affinity.

Ion Channel Research: Chlorotoxin's high affinity for certain chloride channels, especially those expressed in neuronal and glial cells, makes it a powerful probe for ion channel characterization. Researchers utilize the linear peptide to investigate the structural requirements for channel binding, gating mechanisms, and the physiological roles of chloride conductance in excitable tissues. By comparing the activity of the linear versus folded forms, scientists can elucidate how peptide conformation influences channel modulation, advancing understanding of chloride channel pharmacology and function.

Cancer Cell Targeting: The selective interaction of chlorotoxin with MMP-2 and chloride channels overexpressed in malignant glioma and other tumor cells underpins its application in tumor biology research. The linear analog enables detailed studies of peptide-receptor binding, facilitating the mapping of essential residues involved in tumor cell recognition. Experimental use of the linear form helps clarify the contribution of peptide folding to specificity and affinity, supporting the rational design of novel peptide-based targeting agents or imaging probes for cancer research.

Peptide Structure-Activity Relationship Studies: The linear version of chlorotoxin is instrumental in structure-activity relationship (SAR) analyses, allowing systematic modifications and comparative assays to determine how sequence and conformation affect biological function. By synthesizing and testing variants with altered side chains or backbone structures, researchers can identify key determinants of bioactivity, stability, and receptor engagement. These insights are vital for the development of optimized peptide analogs with tailored properties for research applications.

Peptide Synthesis and Engineering: As a model for disulfide-rich peptides, linear chlorotoxin serves as a reference in peptide synthesis protocols and folding studies. Its use in synthetic chemistry laboratories enables the evaluation of folding pathways, oxidation strategies, and the impact of linear versus folded states on peptide solubility and aggregation. These investigations inform best practices for the production and handling of cysteine-rich peptides, aiding in the advancement of peptide engineering and manufacturing technologies.

Analytical and Binding Assays: In biochemical and biophysical research, the linear analog is employed in binding assays to dissect the molecular interactions between chlorotoxin and its targets. Its distinct conformation allows for comparative analyses with the native folded peptide, providing a means to quantify binding kinetics, thermodynamics, and specificity. Such assays are essential for validating the selectivity of peptide-target interactions, optimizing assay conditions, and supporting the development of high-throughput screening platforms for ion channel modulators or tumor-targeting ligands.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide Modification ServicesEpitope Mapping ServicesCustom Conjugation ServicecGMP Peptide ServicePeptide CDMOPeptide Nucleic Acids SynthesisPeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers