Cotadutide acetate
Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide acetate (MEDI0382 acetate) exhibits ability to facilitate both weight loss and glycaemic control, has the potential for obesity and type 2 diabetes (T2D) treatment.
Online Inquiry
| CAT# | R1943 |
| Synonyms/Alias | MEDI 0382 acetate; MEDI-0382 acetate; MEDI0382 acetate |
| M.F/Formula | C169H256N42O57 |
| M.W/Mr. | 3788.14 |
| Sequence | One Letter Code: 1'-{palmtoyl-Glu}; HSQGTFTSDKSEYLDSERARDFVAWLEAGG (Amide bridge: Glu1'-Lys10)
Three Letter Code: 1'-{palmtoyl-Glu}; His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Lys-Ser-Glu-Tyr-Leu-Asp-Ser-Glu-Arg-Ala-Arg-Asp-Phe-Val-Ala-Trp-Leu-Glu-Ala-Gly-Gly (Amide bridge: Glu1'-Lys10) |
| Activity | Agonist |
| Biological Activity | Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 values of 6.9 pM and 10.2 pM, respectively. |
| Storage | Store at -20°C |
Solubility | DMSO: 2 mg/mL (0.53 mM); H2O: < 0.1 mg/mL (insoluble) |
Write a review
Ask a question
My Review for Cotadutide acetate
Required fields are marked with *
×
Ask a Question for Cotadutide acetate
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
