Cotadutide acetate

Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide acetate (MEDI0382 acetate) exhibits ability to facilitate both weight loss and glycaemic control, has the potential for obesity and type 2 diabetes (T2D) treatment.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1943

Synonyms/Alias:MEDI 0382 acetate; MEDI-0382 acetate; MEDI0382 acetate

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C169H256N42O57
M.W/Mr.
3788.14
Sequence
One Letter Code: 1'-{palmtoyl-Glu}; HSQGTFTSDKSEYLDSERARDFVAWLEAGG (Amide bridge: Glu1'-Lys10)
Three Letter Code: 1'-{palmtoyl-Glu}; His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Lys-Ser-Glu-Tyr-Leu-Asp-Ser-Glu-Arg-Ala-Arg-Asp-Phe-Val-Ala-Trp-Leu-Glu-Ala-Gly-Gly (Amide bridge: Glu1'-Lys10)
Activity
Agonist
Biological Activity
Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 values of 6.9 pM and 10.2 pM, respectively.

Cotadutide acetate is a synthetic peptide compound that functions as a dual agonist of the glucagon-like peptide-1 (GLP-1) and glucagon receptors. Structurally engineered to mimic endogenous peptide hormones, it exhibits unique pharmacodynamic properties that have garnered significant interest within metabolic research and peptide pharmacology. Its dual receptor activity enables the modulation of multiple metabolic pathways, making it an invaluable tool for investigating complex endocrine signaling, energy homeostasis, and peptide-receptor interactions. As a research-use-only reagent, cotadutide acetate offers a reliable means to interrogate the molecular mechanisms underlying metabolic regulation and peptide-based signaling cascades.

Metabolic pathway elucidation: Researchers employ cotadutide acetate to dissect the integrated signaling networks of GLP-1 and glucagon receptors in metabolic tissues. By activating both receptor subtypes, the peptide facilitates the study of crosstalk between insulinotropic and glucagonotropic pathways, enabling detailed analyses of glucose homeostasis, hepatic glucose output, and lipid metabolism. This dual agonist model supports investigations into the physiological roles of incretin and glucagon systems in energy balance and metabolic adaptation.

Peptide receptor pharmacology: The compound serves as a robust tool for characterizing receptor binding affinities, downstream signaling events, and functional selectivity in cellular and tissue-based assays. Its well-defined structure and dual activity profile allow for precise evaluation of receptor activation, desensitization, and cross-regulation, providing valuable insights into the pharmacological modulation of peptide hormone receptors. Such studies are critical for advancing the understanding of receptor dynamics and ligand specificity within the GPCR superfamily.

Peptide synthesis and analog development: Cotadutide acetate is often utilized as a reference standard or template in the synthesis of novel peptide analogs targeting metabolic receptors. Its sequence and dual-agonist properties inform structure-activity relationship (SAR) studies aimed at optimizing peptide stability, bioactivity, and selectivity. By serving as a benchmark compound, it supports the rational design and screening of next-generation peptide therapeutics and research probes.

Cell signaling research: In vitro and ex vivo models benefit from the application of this dual agonist to probe intracellular signaling cascades downstream of GLP-1 and glucagon receptor activation. Researchers leverage its activity to map second messenger systems, such as cAMP production and PKA pathway engagement, as well as to investigate the interplay between metabolic signaling and cellular energy sensors. These studies enhance the mechanistic understanding of peptide-driven cellular responses in metabolic tissues.

Assay development and validation: The reliable pharmacological profile of cotadutide acetate makes it an ideal positive control or reference ligand in a variety of bioanalytical and receptor-based assays. Its use in assay calibration, validation, and performance benchmarking ensures reproducibility and accuracy in high-throughput screening, ligand binding studies, and functional assays targeting GLP-1 and glucagon receptor pathways. This application is essential for laboratories seeking to establish robust and sensitive assay platforms for peptide-receptor research.

Long-term Storage Conditions
DMSO: 2 mg/mL (0.53 mM); H2O: < 0.1 mg/mL (insoluble)
References
1. Henderson SJ,et al. Robust anti-obesity and metabolic effects of a dual GLP-1/glucagon receptor peptide agonist in rodents and non-human primates.Diabetes Obes Metab. 2016 Dec;18(12):1176-1190.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOPeptide Analysis ServicesCustom Conjugation ServicePeptide Modification ServicesPeptide Synthesis ServicesEpitope Mapping ServicescGMP Peptide ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers