Home > Product > Antimicrobial Peptides > Ct-AMP1

Antimicrobial Peptides

CAT#
AF3255
Sequence
NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFDC
Host Chemicals
Clitoria ternatea
Length
49
Activity
Gram+, Fungi,

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.