Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GFGSLFKFLAKKVAKTVAKQAAKQGAKYIANKQME |
Activity | Antibacterial |
Host Chemicals | Cupiennius salei |
Length | 35 |
SwissProt ID | P83620 |
1. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
4. TMEM16F and dynamins control expansive plasma membrane reservoirs
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.