CAT# | AF2406 |
Sequence | GFGALFKFLAKKVAKTVAKQAAKQGAKYVVNKQME |
Activity | Antibacterial |
Host Chemicals | Cupiennius salei | Length | 35 | SwissProt ID | P83619 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2226 | Brevinin-2E-OG4 antimicrobial peptide | Inquiry | ||
AF2036 | Hyfl D | Inquiry | ||
AF1705 | Ranatuerin-2AVa | Inquiry | ||
AF3338 | BACTENECIN 7 | Inquiry | ||
AF283 | Temporin-La | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Basic Fibroblast Growth Factor, Human, called basic fibroblast growth factor (bFGF/FGF-b/FGF-2), is a single cha ...
PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...
Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...
Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...
Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...