CAT# | AF2313 |
Sequence | SQWVTPNHAACAAHCLLRGNRGGECKGTICHCR |
Activity | Antibacterial |
Host Chemicals | Triatoma brasiliensis | Length | 33 | SwissProt ID | C6ZEC4 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF753 | Ranacyclin-B-RL1 | Inquiry | ||
AF1378 | Salivary glands defensin | Inquiry | ||
AF336 | Mastoparan M | Inquiry | ||
AF1398 | Hymo B | Inquiry | ||
AF2682 | Bacteriocin L-1077 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...
BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...
Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...
APETx2, a 42 amino-acid peptide toxin isolated from sea anemone Anthopleura elegantissima, is a kind of acid-s ...
5. Synthetic Peptides Targeting CD36 Attenuate Lipopolysaccharide-Induced InflammationSynthetic amphipathic helical peptides ...