CAT# | AF3171 |
Sequence | RTCESPSNKFQGVCLNSQSCAKACPSEGFSGGRCSSLRCYCSKAC |
Activity | Antifungal |
Host Chemicals | Arabidopsis thaliana | Length | 45 | SwissProt ID | Q9ZUL8 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1285 | Brevinin-1CG2 | Inquiry | ||
AF477 | Buforin-EC | Inquiry | ||
AF3186 | Esculentin-1A | Inquiry | ||
AF2960 | Beta-defensin 33 | Inquiry | ||
AF664 | Lantibiotic cinnamycin | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...
The hexapeptide-9, a cosmetic peptide of skin agingSkin aging is the obvious external manifestation of a natural ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...
Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...