Keywords Search Google Search Search

Defensin-like protein 16

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	D06005
Sequence	QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC

CAT#	Product Name	Inquiry
D01002	Defensin-1 (human) HNP-1	Inquiry
D01001	Defensin (human) HNP-2	Inquiry
D06012	CHRG01; Human β-Defensin 3 (hBD3) Derivative	Inquiry
D06006	Alpha-defensin-related sequence 10	Inquiry
D01007	rec beta-Defensin 1 (human)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of spadin in neurological treatment of depression

Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...

The Usage of Pentapeptide-31

of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...

Function of phosphoramidon as an endothelin converting enzyme inhibitor

Phosphoramidon is a kind of thermolysin inhibitor isolated from a culture filtrate of streptomyces. It has prove ...

St-Ht31 P, an AKAP inhibitor

The peptide st-Ht31 P, A-kinase anchoring protein (AKAP) inhibitor, has the negative control for st-Ht31. In DRG ...

Palmitoyl Tripeptide-5

of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Length	51
Modifications	Disulfide bonds(4)