Home > Product > Catalog Peptides > Others > Defensin-like protein 16

Others

Defensin-like protein 16

Price Inquiry
CAT#
D06005
Sequence
QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC
Modifications
Disulfide bonds(4)
Length
51

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.