Home > Product > Antimicrobial Peptides > Drosomycin-2

Antimicrobial Peptides

Drosomycin-2

Price Inquiry
CAT#
AF3060
Sequence
DCLSGKYKGPCAVWDNEMCRRICKEEGHISGHCSPSLKCWCEGC
Host Chemicals
fruit fly, Drosophila melanogaster
Length
44
Activity
Fungi, Parasites,

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.