CAT# | AF3174 |
Sequence | TMKKPLLLIVLLGIISLSLCEQERAADEDEGSEIKRGIFSKFAGK |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...