Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GIFSLIKGAAKVVAKGLGKEVGKFGLDLMACKVTNQC |
Activity | Antimicrobial |
Host Chemicals | Rana fukienensis |
Length | 37 |
SwissProt ID | Q1MU22 |
1. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.