FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1365

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
3692.15
Sequence
One Letter Code: FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
three Letter Code: Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a synthetic peptide sequence designed for advanced biochemical research applications. As a peptide compound, it represents a defined chain of amino acids with a precise primary structure, enabling targeted studies of protein-protein interactions, signaling pathways, and structure-function relationships. The unique sequence of this peptide allows researchers to investigate specific molecular mechanisms relevant to cellular communication, enzymatic recognition, or binding specificity, making it a valuable tool in modern peptide science and molecular biology.

Peptide structure-function analysis: Researchers frequently employ this synthetic peptide in structure-function studies to dissect the role of individual amino acid residues within larger protein domains. By introducing this sequence as a model substrate or as part of mutational analyses, scientists can assess how specific side chains contribute to binding affinity, conformational stability, or biological activity. Such investigations provide critical insights into the determinants of protein folding and molecular recognition, supporting the rational design of biomolecules with tailored properties.

Enzyme substrate assays: The defined primary structure of this peptide makes it an ideal candidate for use as a substrate in enzymatic activity assays. Proteases, kinases, or other modifying enzymes can be tested for their ability to recognize, cleave, or modify the sequence, facilitating the characterization of enzyme specificity and kinetics. These assays are essential for elucidating catalytic mechanisms, screening for enzyme inhibitors, and validating biochemical pathways in both basic and applied research contexts.

Protein interaction mapping: This peptide can serve as a probe in studies aimed at mapping protein-protein interactions. By immobilizing the sequence on solid supports or incorporating it into pull-down assays, researchers can identify binding partners, interaction motifs, or regulatory domains within complex biological samples. Such applications are vital for understanding the molecular basis of cellular signaling, scaffolding, and assembly of multi-protein complexes.

Antibody epitope characterization: The sequence can be utilized as an antigenic epitope for generating or validating antibodies in immunological assays. Synthetic peptides like this one allow for precise mapping of antibody binding sites, assessment of specificity, and development of custom immunoreagents. These approaches are widely used in immunodetection, biomarker discovery, and the optimization of assay sensitivity and selectivity.

Peptide-based assay development: The unique properties of this peptide support its use in developing and optimizing various in vitro assays, including biosensor platforms, high-throughput screening formats, and quantitative binding studies. Its well-defined sequence enables reproducible assay conditions and facilitates the standardization of experimental protocols, which is critical for generating reliable and comparable data across different laboratories and research projects.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesCustom Conjugation ServicePeptide CDMOcGMP Peptide ServiceEpitope Mapping ServicesPeptide Modification ServicesPeptide Nucleic Acids SynthesisPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers