Home > Product > Antimicrobial Peptides > Garvieacin Q

Antimicrobial Peptides

Garvieacin Q

Price Inquiry
CAT#
AF3259
Sequence
EYHLMNGANGYLTRVNGKTVYRVTKDPVSAVFGVISNCWGSAGAGFGPQH
Host Chemicals
lactic acid bacteria, Lactococcus garvieae BCC 43578
Length
50
Activity
Gram+,

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.