Gastric Inhibitory Peptide (1-39), human

Gastric Inhibitory Peptide (1-39), human represents the full-length human GIP sequence. The peptide adopts flexible helical elements that contact the GIP receptor and related partners. Researchers employ it to study secretion, receptor activation, and proteolytic processing. Its native sequence underpins extensive biochemical and structural investigations of GIP biology.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G02005

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C195H287N49O57S1
M.W/Mr.
4261.82
Sequence
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDW
Length
36

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide CDMOPeptide Modification ServicesPeptide Analysis ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesiscGMP Peptide ServicePeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers