Gastrin, chicken

Gastrin, chicken is a species-specific regulatory peptide used to compare evolutionary conservation in gastrointestinal signaling systems. Its sequence provides insight into amino acid variations influencing receptor interactions. Researchers utilize it to explore biochemical dynamics of hormone processing. The molecule supports cross-species structural and functional analyses.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G03020

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C190H265N47O51S1
M.W/Mr.
4055.6
Sequence
FLPHVFAELSDRKGFVQGNGAVEALHDFYPDWMDF-NH2
Length
35

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicecGMP Peptide ServicePeptide CDMOEpitope Mapping ServicesPeptide Analysis ServicesPeptide Nucleic Acids SynthesisPeptide Synthesis ServicesPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers