Keywords Search Google Search Search

GIP, porcine

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	G02008
M.W/Mr.	4975.6
Sequence	YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ

CAT#	Product Name	Inquiry
AF2506	Gastric inhibitory polypeptide	Inquiry
G02007	(Pro3) Gastric Inhibitory Peptide (GIP), human	Inquiry
G02006	GIP (3-42), human	Inquiry
G02002	Gastric Inhibitory Polypeptide (6-30) amide (human)	Inquiry
G02005	Gastric Inhibitory Peptide (1-39), human	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

GaTx2, a Peptide Inhibitor of ClC-2 Chloride Channels

ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...

Function of pergolide mesylate salt in Parkinson's disease

Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...

Function of leuprolide acetate in disorders of the reproductive system

Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...

Function of Kassinin in Stimulating Ion Transport in Skin

Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...

Function of Abarelix in Advanced Prostate Cancer

Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: