Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4975.6 |
Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
Length | 42 |
1. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
2. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.