Gloverin

Gloverin is an insect-derived peptide containing clusters of acidic and hydrophobic residues that contribute to β-structure formation. The sequence exhibits stability suited for examining protein-peptide interaction pathways. Its physicochemical properties promote binding studies in model systems. Research applications include structural mapping, motif-function analysis, and biochemical characterization.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G13001

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
Sequence
VFGTLGSTDDSLFGRYKQDIFNDHRGHLQGQAYGSR
Length
36

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisPeptide Modification ServicesPeptide Synthesis ServicesPeptide Analysis ServicesEpitope Mapping ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers