Home > Product > Catalog Peptides > Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2) > GLP-1 (7-36), amide, chicken, common turkey

Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)

GLP-1 (7-36), amide, chicken, common turkey

Price Inquiry
CAT#
G16004
Sequence
AEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2
M.W/Mr.
3327.7
Molecular Formula
C149H224N40O47
Length
29

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.