GLP-1 (7-36), amide, chicken, common turkey

GLP-1 (7-36), amide, chicken, common turkey provides avian GLP-1 analogs with C-terminal amidation for increased stability. The sequences are valuable for comparing GLP-1 signaling features across vertebrate classes. Researchers use them to examine receptor recognition, structure, and degradation in birds. Their cross-species nature aids evolutionary and functional mapping.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G16004

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C149H224N40O47
M.W/Mr.
3327.7
Sequence
AEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2
Length
29

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide Nucleic Acids SynthesisPeptide CDMOPeptide Modification ServicesCustom Conjugation ServicePeptide Analysis ServicesEpitope Mapping ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers