CAT# | C06011 |
M.F/Formula | C145H239N43O49S2 |
M.W/Mr. | 3432.9 |
Sequence | CSNLSTCVLGKLSQELHKLETYPRTNTGSGTP-NH2 |
Length | 32 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C06010 | Calcitonin (salmon I) | Inquiry | ||
C06009 | Calcitonin (human) | Inquiry | ||
C06021 | (Des-Cys1,cyclo(Ser2-Asu7))-Calcitonin (eel) | Inquiry | ||
C06012 | Calcitonin, porcine | Inquiry | ||
C06022 | Biotinyl-(Cys1,Lys(biotinyl)18)-Calcitonin (human) | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
GR 94800, is a linear heptapeptide with the structure of PhCO-Ala-Ala-D-Trp-Phe-D-Pro-Nle Amide, which is a high ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...