Glu20-salmon calcitonin

Glu20-salmon calcitonin is a modified peptide used to analyze stabilization and folding of calcitonin-family hormones. Its substitution at Glu20 provides insights into residue-specific contributions to conformation. Researchers explore receptor-binding determinants via structural assessment. The molecule contributes to comparative calcitonin studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: C06011

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C145H239N43O49S2
M.W/Mr.
3432.9
Sequence
CSNLSTCVLGKLSQELHKLETYPRTNTGSGTP-NH2
Length
32

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOEpitope Mapping ServicesPeptide Analysis ServicesPeptide Synthesis ServicesPeptide Nucleic Acids SynthesiscGMP Peptide ServiceCustom Conjugation ServicePeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers