CAT# | G16007 |
M.F/Formula | C166H256N44O56S1 |
M.W/Mr. | 3796.2 |
Sequence | ADGSFSDEMNTILDNLATRDFINWLIQTKITD |
Length | 32 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
G16006 | GLP-2, human | Inquiry | ||
G16016 | (Met(O)27)-Glucagon (1-29) (human, rat, porcine) | Inquiry | ||
10-101-59 | Liraglutide | Inquiry | ||
CAD-111 | GLP-1(7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) | Inquiry | ||
G05010 | Oxyntomodulin / Glucagon 37 | Inquiry |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).