Glucagon-Like Peptide II, rat

CAT#	G16007
M.F/Formula	C166H256N44O56S1
M.W/Mr.	3796.2
Sequence	ADGSFSDEMNTILDNLATRDFINWLIQTKITD

Length

32

CAT#	Product Name	M.W	Molecular Formula	Inquiry
G16006	GLP-2, human			Inquiry
G16016	(Met(O)27)-Glucagon (1-29) (human, rat, porcine)			Inquiry
10-101-59	Liraglutide			Inquiry
CAD-111	GLP-1(7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat)			Inquiry
G05010	Oxyntomodulin / Glucagon 37			Inquiry

1. Olfactory receptor based piezoelectric biosensors for detection of alcohols related to food safety applications

2. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate

3. Investigating Potential Interactions Between Neurohypophyseal Peptides, their Drug Analogs, and Coagulation Factor VIII

4. P-selectin and Complement’s Role in a Neonatal Model of Germinal Matrix Hemorrhage-Induced Secondary Injury

5. cRGD-functionalized, DOX-conjugated, and 64Cu-labeled superparamagnetic iron oxide nanoparticles for targeted anticancer drug delivery and PET/MR imaging