Visit Us at the Neuroscience 2024 in McCormick Place, Chicago from Oct 5-9, 2024 (Booth number #351).

Glucagon-Like Peptide II, rat

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	G16007
M.F/Formula	C166H256N44O56S1
M.W/Mr.	3796.2
Sequence	ADGSFSDEMNTILDNLATRDFINWLIQTKITD

CAT#	Product Name	Inquiry
G16014	(Des-Thr7)-Glucagon	Inquiry
10-101-18	Glucagon	Inquiry
G16024	GLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat)	Inquiry
G16032	GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human	Inquiry
G16001	Glucagon - Like Peptide 1, GLP - 1 (7 - 17) - Cys	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of P11 in a protein chip system

P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...

Function of pergolide mesylate salt in Parkinson's disease

Pergolide mesylate salt , also known as 8-beta-((methylthio)methyl)-D-6-propylergoline methanesulfonate, is a ...

Aclerastide [DSC127] as a Therapy for the Treatment of Diabetic Foot Ulcers

Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...

Acetyl tetrapeptide: A multifunctional biomimetic peptide

Peptides are compounds formed by linking α-amino acids by peptide bonds, and are intermediate products of proteolysis. They a ...

PBP 10, a highly specific FPR2 antagonist

PBP 10 (RhoB-Glu-Arg-Leu-Phe-Glc-Val-Lys-Glc-Arg-Arg) is a 10-aa-long rhodamine-linked and membrane-permeable pe ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: