Keywords Search Google Search Search

Gly-Pro-Glu

Gly-Pro-Glu is a peptide compound extensively utilized in the biomedical industry. This product exhibits potential inhibitory effects on neovascularization, thereby aiding in the prevention and management of this debilitating condition.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1990
CAS	32302-76-4
Chemical Name	(2S)-2-[[(2S)-1-(2-aminoacetyl)pyrrolidine-2-carbonyl]amino]pentanedioic acid
M.F/Formula	C12H19N3O6
M.W/Mr.	301.30

CAT#	Product Name	Inquiry
R1227	Autocamtide-2-related inhibitory peptide TFA	Inquiry
R1365	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Inquiry
R0893	PR 39 (porcine)	Inquiry
R1829	PEG-MGF	Inquiry
R1399	GRGDSP TFA	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of myristoyl pentapeptide-11 in skin

Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...

PAC-113: A clinically active antimicrobial peptide

PAC-113, as well as a new type of Trp-rich peptide, is a 12 amino-acid fragment of the saliva protein histatin 5 ...

Ornipressin: a synthetic derivative of vasopressin

Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...

Palmitoyl Tripeptide-1

Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...

Function of L-Ornithine α-Ketoglutarate Monohydrate in Cerebral Hypoxia

L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
InChI	InChI=1S/C12H19N3O6/c13-6-9(16)15-5-1-2-8(15)11(19)14-7(12(20)21)3-4-10(17)18/h7-8H,1-6,13H2,(H,14,19)(H,17,18)(H,20,21)/t7-,8-/m0/s1
InChI Key	JJGBXTYGTKWGAT-YUMQZZPRSA-N
Canonical SMILES	C1CC(N(C1)C(=O)CN)C(=O)NC(CCC(=O)O)C(=O)O
Isomeric SMILES	C1C[C@H](N(C1)C(=O)CN)C(=O)N[C@@H](CCC(=O)O)C(=O)O