GRF, mouse

GRF, mouse, is a species variant used for comparative evaluation of sequence-dependent folding in growth-regulating peptides. Its motif supports structural alignment studies with human GRF. Researchers examine residue changes for insights into evolutionary divergence. The peptide enriches comparative endocrinology.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G09007

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C220H365N69O64S1
M.W/Mr.
5032.9
Sequence
VDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS
Length
41

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Nucleic Acids SynthesisPeptide Modification ServicesEpitope Mapping ServicesPeptide CDMOcGMP Peptide ServicePeptide Synthesis ServicesCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers