CAT# | G09007 |
M.F/Formula | C220H365N69O64S1 |
M.W/Mr. | 5032.9 |
Sequence | VDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS |
Length | 41 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
G09009 | GRF (free acid) (human) | Inquiry | ||
G09006 | GRF (1-40), human | Inquiry | ||
G09008 | Growth Hormone Releasing Factor, GRF (1 - 44), amide, human | Inquiry | ||
G09001 | PPT, Prepro Thyrotropin-Releasing Hormone (TRH) (160-169) | Inquiry | ||
G09003 | GRF (1-29) amide (rat) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Aviptadil acetate, the nonproprietary or generic name for a vasoactive intestinal peptide (VIP), is a synthetic ...
GLP-1 is a 30 amino acid peptide (molecular weight of 3297.5) secreted by intestinal L-cells in response to meal ingestion wi ...
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...
Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...
Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...