CAT# | G09007 |
M.F/Formula | C220H365N69O64S1 |
M.W/Mr. | 5032.9 |
Sequence | VDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...