CAT# | G09011 |
M.F/Formula | C221H368N72O66S |
M.W/Mr. | 5121.86 |
Sequence | YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 |
Length | 44 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
G09008 | Growth Hormone Releasing Factor, GRF (1 - 44), amide, human | Inquiry | ||
G09020 | Acetyl-(Tyr1,D-Arg2)-GRF (1-29) amide (human) | Inquiry | ||
G09021 | Acetyl-(Tyr1,D-Phe2)-GRF (1-29) amide (human) | Inquiry | ||
G09012 | Growth Hormone (1-43), human | Inquiry | ||
G09015 | (beta-Asp3)-GRF (human) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Carnosine (β-alanyl-l-histidine), containing an imidazole moiety, is an intramuscular dipeptide consisting of β ...
Aviptadil acetate, the nonproprietary or generic name for a vasoactive intestinal peptide (VIP), is a synthetic ...
Glucagon is a 29-amino acid peptide hormone that is synthesized in pancreatic α cells from the proglucagon precursor by proho ...
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...
Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...