Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C221H368N72O66S |
M.W/Mr. | 5121.86 |
Sequence | YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 |
Length | 44 |
3. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
4. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.