CAT# | G09011 |
M.F/Formula | C221H368N72O66S |
M.W/Mr. | 5121.86 |
Sequence | YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...