Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C221H368N72O66S |
M.W/Mr. | 5121.86 |
Sequence | YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 |
Length | 44 |
3. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
5. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.