This is a 5.1kDa 45-amino acid antimicrobial peptide called beta-Defensin-3 (hBD-3) having a beta sheet with three intramolecular disulfide bonds. It is expressed in high levels in keratinocytes and tonsilar tissue while expressed low in epithelia of the respiratory, gastrointestinal and genito-urinary tracts. Factors that induce its expression include TNF-alpha, IL-1beta and bacteria such as P. aeruginosa and S. aureus. hBD-3 is also potentially induced after exposure to IFN-gamma. In contrast to hBD-1, -2 and -4, hBD-3 demonstrates a salt-insensitive antimicrobial activity towards several pathogenic microorganisms at physiologic salt concentrations. This makes hBD-3 uniquely and particularly relevant in diseases where other hBDs show inactivity. The ability of hBD-3 to elicit its antimicrobial activity more effectively at the concentrations lower that those of hBD-1 and hBD-2 has been attributed to its amphipathic dimer structure and the increased positive surface charge (+9), compared to hBD-1 (+4) and hBD-2 (+6). hBD-3 has been shown to induce cytokine production from human keratinocytes and stimulates monocyte migration.
CAT# | X21137 |
M.W/Mr. | 5155.4 |
Sequence | One Letter Code: GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41) Three Letter Code: H-Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys-OH (Disulfide bridge:11-40,18-33,23-41) |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Pep2m, a peptide inhibitor of GluA2 subunit binding to NSF, reduces α-amino- 3-hydroxy-5-methyl-isoxazolepropion ...
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...
AdTx1, also called as ρ-Da1a, is a polypeptide of 65 amino acids stabilized by four disulfide bonds, which has a ...
Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...