Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | LEEAASSDTPVAAYQEMSMESRMMPDHVRQKRQSHLSMCRW |
Activity | Antimicrobial |
Host Chemicals | Epinephelus moara |
Length | 41 |
SwissProt ID | F1JYN2 |
1. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
2. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.