Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GWFKKAWRKVKNAGRRVLKGVGIHYGVGLI |
Activity | Antibacterial, Antifungal |
Host Chemicals | Myxine glutinosa |
Length | 30 |
1. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
3. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.