Products
Home > Functional Peptides > Antimicrobial Peptides > Hinnavin II

If you find Creative Peptides is useful to satisfy your needs, please do not hesitate to contact us!

Hinnavin II

CAT#
AF2727
Sequence
KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG
Host Chemicals
Artogeia rapae
Length
38
Activity
Antibacterial
SwissProt ID
Q68KS5

Useful Tools

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
Customer Support & Price Inquiry
  • Please enter the code "peptides"

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

Follow us on:

Copyright © 2008 - Creative Peptides. All rights reserved.

USA

Address: 45-16 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

E-Mail:

Europe

Tel: 44-207-097-1828

E-Mail: