Home > Product > Antimicrobial Peptides > Hinnavin II

Antimicrobial Peptides

Hinnavin II

Price Inquiry
CAT#
AF2727
Sequence
KWKIFKKIEHMGQNIRDGLIKAGPAVQVVGQAATIYKG
Host Chemicals
Artogeia rapae
Length
38
Activity
Antibacterial
SwissProt ID
Q68KS5

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.