Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | SISCGETCTTFNCWIPNCKCNHHDKVCYWN |
Activity | Antimicrobial |
Host Chemicals | Hybanthus floribundus E |
Length | 30 |
3. Myotropic activity of allatostatins in tenebrionid beetles
5. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.