1. Home
  2. Products
  3. Catalog Peptides
  4. Parathyroid Hormones and Related Peptides
  5. (Ile⁵,Trp²³,Tyr³⁶)-PTHrP (1-36)

(Ile⁵,Trp²³,Tyr³⁶)-PTHrP (1-36)

(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a peptide analog related to parathyroid hormone, containing specific modifications that alter receptor interaction and signal transduction. This compound is essential in bone metabolism research and studies on the regulation of calcium homeostasis. It offers a valuable tool for investigating the physiological roles of PTH-related proteins in skeletal and endocrine systems.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: P03037

CAS No:181057-31-8

Synonyms/Alias:(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat);

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C196H308N58O53
M.W/Mr.
4324.96
Sequence
AVSEIQLLHDKGKSIQDLRRRFWLHHLIAEIHTAEY
Length
36

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide CDMOPeptide Synthesis ServicescGMP Peptide ServicePeptide Modification ServicesPeptide Analysis ServicesEpitope Mapping Services
Hot Products
Deslorelin Acetate

Deslorelin Acetate is a potent GnRH analog peptide for fertility control research. Order Deslorelin peptide from a professional peptide supplier for veterinary applications.

Read More Read More
Fertirelin Acetate

Fertirelin Acetate is a synthetic peptide that promotes ovulation and fertility. Purchase Fertirelin research peptide for breeding and hormonal studies.

Read More Read More
Deslorelin

Deslorelin peptide is a potent GnRH agonist used for fertility and hormonal control. Buy Deslorelin peptide powder online for veterinary and endocrine research applications.

Read More Read More
Aviptadil Acetate

Aviptadil Acetate is a vasoactive intestinal peptide for lung and immune research. Purchase this synthetic peptide for studies on pulmonary health and inflammation.

Read More Read More
GLP-1 (7-36) amide Acetate

GLP-1 (7-36) amide Acetate peptide enhances insulin secretion and glucose balance. Buy this research peptide for diabetes and metabolic disorder studies.

Read More Read More
Terlipressin Acetate

Terlipressin Acetate is a synthetic vasopressin analog peptide used for vascular and liver research. Buy Terlipressin peptide powder online from a trusted peptide supplier for professional studies.

Read More Read More
Thymopentin Acetate

Thymopentin Acetate peptide enhances immune modulation and T-cell function. Purchase Thymopentin research peptide online for immunotherapy and cell biology research.

Read More Read More
Argipressin

Argipressin peptide regulates water balance and blood pressure in biological systems. Shop pure Argipressin peptide online for cardiovascular and kidney research.

Read More Read More
Angiotensin II

Angiotensin II peptide regulates blood pressure and vascular constriction. Purchase this synthetic research peptide to support cardiovascular and renal function studies.

Read More Read More
Lanreotide Acetate

Lanreotide Acetate is a somatostatin analog peptide regulating hormone secretion. Purchase Lanreotide peptide online to study tumor suppression and endocrine disorders.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers