Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₂₁₉H₃₄₉N₆₉O₆₆S₃ |
M.W/Mr. | 5100.8 |
Sequence | One Letter Code: TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH₂ three Letter Code: H-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH₂ trifluoroacetate salt (Disulfide bond) |
Source# | Synthetic |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
3. Cationic cell-penetrating peptides are potent furin inhibitors
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.