LL-37, Human

LL-37, Human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, Human could help protect the cornea from infection and modulates wound healing.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
LL-37, Human(CAS 154947-66-7)

CAT No: R1488

CAS No:154947-66-7

Synonyms/Alias:Cathelicidin;154947-66-7;ropocamptide;LL-37;LL 37;Cathelicidin LL 37;Cap-18;Bac4;cathelicidin LL-37;hCAP 18;CAP18;Antibacterial peptide LL-37;antimicrobial peptide LL-37;LL-37 antibacterial peptide;FA-LL-37;All38 peptide;LL-37(human);LL-37 (Human);LL-37 antiviral peptide;ROPOCAMPTIDE [INN];UNII-3DD771JO2H;LL-37/hCAP18;CAP18,;CAS001;CHEMBL530345;EX-A7429A;Cathelicidin antimicrobial peptide 18;AKOS024458536;RS-2000;DA-54959;FL110043;[LL-37, 37 aa];G13558;LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-acid);Antimicrobial Peptide, Human [LL-37, 37 aa];PROTEIN CAP 18 (RABBIT CATIONIC ANTIMICROBIAL 37-AMINO ACID FRAGMENT);LEU-LEU-GLY-ASP-PHE-PHE-ARG-LYS-SER-LYS-GLU-LYS-ILE-GLY-LYS-GLU-PHE-LYS-ARG-ILE-VAL-GLN-ARG-ILE-LYS-ASP-PHE-LEU-ARG-ASN-LEU-VAL-PRO-ARG-THR-GLU-SER;NH2-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-COOH;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C205H340N60O53
M.W/Mr.
4493
Sequence
One Letter Code:[LL-37, 37 aa]
Three Letter Code:H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
Biological Activity
Antimicrobial peptide derivative of human cathelicidin. Induces FPRL1-mediated chemotaxis of human neutrophils, monocytes and T cells in vitro. Promotes wound healing following skin-targeted electroporation of a plasmid encoding hCAP-18/LL-37 in mice. Also triggers apoptosis in colon cancer cells. Cell permeable.

LL-37, Human is a synthetic peptide corresponding to the naturally occurring human cathelicidin antimicrobial peptide LL-37. As a cationic, amphipathic peptide, it plays a crucial role in the innate immune system, exhibiting broad-spectrum antimicrobial activity and participating in various immunomodulatory processes. Its unique structure, characterized by an α-helical conformation, enables interactions with microbial membranes and host cell components, making it a valuable subject in immunology, microbiology, and peptide biochemistry research. The study of LL-37 has significantly advanced our understanding of host defense mechanisms, inflammation, and peptide-based modulation of biological pathways.

Antimicrobial research: LL-37 is widely employed in investigations of host-pathogen interactions and innate immune defense. Its ability to disrupt bacterial, fungal, and viral membranes renders it an important model for studying antimicrobial mechanisms and the development of resistance. Researchers utilize this peptide to elucidate the molecular determinants of membrane permeabilization, assess the efficacy of novel antimicrobial agents, and explore strategies to potentiate endogenous peptide activity against multidrug-resistant pathogens.

Immunomodulation studies: The peptide serves as a key tool for probing the modulation of immune cell function. LL-37 influences chemotaxis, cytokine release, and the activation of various immune cells, including neutrophils, monocytes, and dendritic cells. Experimental systems often incorporate LL-37 to dissect signaling pathways involved in inflammation, immune cell recruitment, and the resolution of infectious or inflammatory insults, providing insight into the regulation of innate and adaptive immune responses.

Peptide structure-function analysis: LL-37 is frequently utilized in structure-activity relationship (SAR) studies aimed at understanding how specific amino acid residues and secondary structures contribute to its biological activity. By synthesizing and testing analogs or fragments of LL-37, researchers can map functional domains responsible for antimicrobial potency, membrane binding, and immunomodulatory effects. Such studies inform the rational design of next-generation peptide therapeutics and biomimetics.

Biofilm inhibition assays: The peptide is a valuable agent for investigating the prevention and disruption of microbial biofilms, which are resilient communities of microorganisms implicated in persistent infections and industrial fouling. LL-37's capacity to penetrate and destabilize biofilm matrices is assessed in vitro using a variety of pathogenic and environmental organisms. These assays help clarify the mechanisms by which host-derived peptides counteract biofilm-associated resistance and support the development of anti-biofilm strategies.

Peptide delivery and formulation research: LL-37 is also explored in the context of peptide delivery systems and formulation science. Researchers examine its stability, cellular uptake, and activity when incorporated into various carriers such as nanoparticles, hydrogels, or liposomes. These studies contribute to optimizing peptide delivery for experimental applications, enhancing bioavailability, and minimizing degradation, which are central challenges in the development of peptide-based research tools and potential therapeutics.

Long-term Storage Conditions
Soluble to 1 mg/ml in water
Shipping Condition
Room temperature in continental US; may vary elsewhere.
InChI
InChI=1S/C205H340N60O53/c1-20-114(16)162(261-179(296)128(66-40-46-86-211)235-176(293)135(74-78-155(273)274)243-170(287)125(63-37-43-83-208)241-192(309)148(106-266)257-174(291)126(64-38-44-84-209)234-171(288)129(67-47-87-225-201(215)216)240-185(302)142(98-119-55-29-24-30-56-119)252-187(304)144(100-121-59-33-26-34-60-121)253-189(306)146(102-158(279)280)233-154(272)104-230-167(284)138(94-109(6)7)248-166(283)122(212)93-108(4)5)194(311)231-105-153(271)232-123(61-35-41-81-206)168(285)242-136(75-79-156(275)276)177(294)251-141(97-118-53-27-23-28-54-118)184(301)238-124(62-36-42-82-207)169(286)236-131(69-49-89-227-203(219)220)181(298)263-164(116(18)22-3)197(314)259-160(112(12)13)195(312)246-134(73-77-151(213)269)175(292)237-132(70-50-90-228-204(221)222)180(297)262-163(115(17)21-2)196(313)245-127(65-39-45-85-210)172(289)256-147(103-159(281)282)190(307)254-143(99-120-57-31-25-32-58-120)186(303)249-139(95-110(8)9)183(300)239-130(68-48-88-226-202(217)218)173(290)255-145(101-152(214)270)188(305)250-140(96-111(10)11)191(308)260-161(113(14)15)199(316)265-92-52-72-150(265)193(310)244-133(71-51-91-229-205(223)224)182(299)264-165(117(19)268)198(315)247-137(76-80-157(277)278)178(295)258-149(107-267)200(317)318/h23-34,53-60,108-117,122-150,160-165,266-268H,20-22,35-52,61-107,206-212H2,1-19H3,(H2,213,269)(H2,214,270)(H,230,284)(H,231,311)(H,232,271)(H,233,272)(H,234,288)(H,235,293)(H,236,286)(H,237,292)(H,238,301)(H,239,300)(H,240,302)(H,241,309)(H,242,285)(H,243,287)(H,244,310)(H,245,313)(H,246,312)(H,247,315)(H,248,283)(H,249,303)(H,250,305)(H,251,294)(H,252,304)(H,253,306)(H,254,307)(H,255,290)(H,256,289)(H,257,291)(H,258,295)(H,259,314)(H,260,308)(H,261,296)(H,262,297)(H,263,298)(H,264,299)(H,273,274)(H,275,276)(H,277,278)(H,279,280)(H,281,282)(H,317,318)(H4,215,216,225)(H4,217,218,226)(H4,219,220,227)(H4,221,222,228)(H4,223,224,229)/t114-,115-,116-,117+,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,160-,161-,162-,163-,164-,165-/m0/s1
InChI Key
POIUWJQBRNEFGX-XAMSXPGMSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisCustom Conjugation ServiceEpitope Mapping ServicesPeptide CDMOPeptide Synthesis ServicesPeptide Analysis ServicesPeptide Modification ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers