LL-37, Human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, Human could help protect the cornea from infection and modulates wound healing.
CAT No: R1488
CAS No:154947-66-7
Synonyms/Alias:Cathelicidin;154947-66-7;ropocamptide;LL-37;LL 37;Cathelicidin LL 37;Cap-18;Bac4;cathelicidin LL-37;hCAP 18;CAP18;Antibacterial peptide LL-37;antimicrobial peptide LL-37;LL-37 antibacterial peptide;FA-LL-37;All38 peptide;LL-37(human);LL-37 (Human);LL-37 antiviral peptide;ROPOCAMPTIDE [INN];UNII-3DD771JO2H;LL-37/hCAP18;CAP18,;CAS001;CHEMBL530345;EX-A7429A;Cathelicidin antimicrobial peptide 18;AKOS024458536;RS-2000;DA-54959;FL110043;[LL-37, 37 aa];G13558;LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-acid);Antimicrobial Peptide, Human [LL-37, 37 aa];PROTEIN CAP 18 (RABBIT CATIONIC ANTIMICROBIAL 37-AMINO ACID FRAGMENT);LEU-LEU-GLY-ASP-PHE-PHE-ARG-LYS-SER-LYS-GLU-LYS-ILE-GLY-LYS-GLU-PHE-LYS-ARG-ILE-VAL-GLN-ARG-ILE-LYS-ASP-PHE-LEU-ARG-ASN-LEU-VAL-PRO-ARG-THR-GLU-SER;NH2-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-COOH;
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
5. Emu oil in combination with other active ingredients for treating skin imperfections
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.
From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.