Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | One Letter Code: SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD Three Letter Code: Ser-Lys-Trp-Gln-His-Gln-Gln-Asp-Ser-Cys-Arg-Lys-Gln-Leu-Gln-Gly-Val-Asn-Leu-Thr-Pro-Cys-Glu-Lys-His-Ile-NH2-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp -COOH |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
1. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
2. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
5. Emu oil in combination with other active ingredients for treating skin imperfections
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.