M-zodatoxin-Lt6a

M-zodatoxin-Lt6a is a cystine-knot toxin with high specificity toward neuronal ion channels. Its compact fold supports mapping of gating transitions and pore-region contacts. Researchers employ it in electrophysiological characterization of channel families. The peptide aids systematic exploration of venom-derived modulators.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: M17008

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
Sequence
QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFNL
Length
33

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide CDMOPeptide Nucleic Acids SynthesisPeptide Synthesis ServicesEpitope Mapping ServicesPeptide Analysis ServicesPeptide Modification ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers