Keywords Search Google Search Search

M-zodatoxin-Lt6b

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	M17007
Sequence	QAFKTFTPDWNKIRNDAKRMQDNLEQMKKRFNLNL

CAT#	Product Name	Inquiry
X05413	PM_12586464	Inquiry
X03098	PM_10676455	Inquiry
X11615	PM_2808359	Inquiry
X09347	PM_18292083	Inquiry
X06934	PM_15307183	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Amyloid Precursor Protein and Alzheimer's Disease

The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...

Basic information of Somatostatin

The Discovery of Somatostatin Somatostatin (SS) is an endogenous peptide hormone isolated, purified and characterized in 1973 ...

Gap 19: Specifically block Cx43 hemichannels inhibitor

Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...

Bombesin and Bombesin-like peptides

Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...

Ziconotide: Use in the treatment of pain

Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: