CAT# | A30004 |
Sequence | ECVPENGHCRDWYDECCEGFYCSCRQPPKCICRNNN |
Length | 36 | Modifications | Asparagine amide;Disulfide bond(4) |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X12299 | PM_3552674 | Inquiry | ||
X15535 | PM_8891597 | Inquiry | ||
X20366 | UP_P84941 | Inquiry | ||
X01702 | PH1PO085_13 | Inquiry | ||
X16862 | PM_9748364 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...
GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...