Mu-agatoxin-Aa1a

Mu-agatoxin-Aa1a is an arthropod-derived peptide toxin known to modulate voltage-gated sodium channels. Its cystine-knot scaffold supports precise control over activation states. Researchers employ it to investigate channel gating mechanisms. The peptide aids advanced toxin–channel structural analysis.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: A30004

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
Sequence
ECVPENGHCRDWYDECCEGFYCSCRQPPKCICRNNN
Length
36
Modifications
Asparagine amide;Disulfide bond(4)

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesCustom Conjugation ServicePeptide Analysis ServicesPeptide Synthesis ServicesPeptide Modification ServicesPeptide Nucleic Acids SynthesisPeptide CDMOcGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers