Myticin-B

CAT#	M21002
Sequence	HPHVCTSYYCSKFCGTAGCTRYGCRNLHRGKLCFCLHCSR

Length

40

CAT#	Product Name	M.W	Molecular Formula	Inquiry
X20364	UP_P84938			Inquiry
X18689	UP_P29262			Inquiry
X19152	UP_P60995			Inquiry
X17680	UP_P01159			Inquiry
X06951	PM_15322074			Inquiry

1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function

2. Myotropic activity and immunolocalization of selected neuropeptides of the burying beetle Nicrophorus vespilloides (Coleoptera: Silphidae)

3. Application of human liver organoids as a patient-derived primary model for HBV infection and related hepatocellular carcinoma

4. Genetic, cellular, and structural characterization of the membrane potential-dependent cell-penetrating peptide translocation pore

5. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors