Nesfatin-1 was recently identified as anorexigenic peptide and is derived from Nucleobindin2 protein. Nesfatin-1 reduces body weight gain, food and water intake in rodents. In humans high levels of Nesfatin-1 in plasma are associated with overweight individuals. In addition, Nesfatin-1 was linked to the anxiety and stress.
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3672.3 |
Sequence | One Letter Code: PDTGLYYDEYLKQVIEVLETDPHFREKLQK-NH2 Three Letter Code: Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-NH2 |
References | 1. Feijóo-Bandín S., et.al., Endocrinology 154 (12), 4757-4767 (2013) 2. Vas S., et.al., PLOS 8 (4), 1-10 (2013) 3. Ramanjaneya M., et.al., Endocrinology 151 (7), 3169-3180 (2010) |
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
4. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
5. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.