Neuropeptide K (human, porcine, rat)

Neuropeptide K (human, porcine, rat) trifluoroacetate salt contains a conserved tachykinin fragment featuring aromatic and basic residues that shape conformation. The peptide supports receptor-binding and structural studies across species. Its salt form enhances solubility. Applications include ligand-interaction profiling, spectroscopic evaluation, and motif-analysis research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: N1939

CAS No:96827-05-3

Synonyms/Alias:Neuropeptide K (human, porcine, rat) trifluoroacetate salt;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₇₅H₂₈₄N₅₂O₅₂S
M.W/Mr.
3980.57
Sequence
One Letter Code: DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM -NH₂
three Letter Code: H-Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu-Tyr-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH₂ trifluoroacetate salt
Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Modification ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide Synthesis ServicesPeptide CDMOPeptide Nucleic Acids SynthesisEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers