Neuropeptide W-30 (human) trifluoroacetate salt

Name: Neuropeptide W-30 (human) trifluoroacetate salt
Brand: Creative Peptides
SKU: N1945
Availability: MadeToOrder

Neuropeptide W-30 (human) trifluoroacetate salt serves as a ligand for GPCR pathways implicated in metabolic and neuroendocrine signaling. Its conformational features support research focused on receptor specificity and ligand-receptor docking. The peptide is frequently used to examine energy-related peptide networks. Its stabilized salt form promotes dependable performance in in vitro assays.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: N1945

CAS No:383415-80-3

Custom Peptide Synthesis

cGMP Peptide

Registration of APIs
CMC information required for an IND

IND and NDA support
Drug master files (DMF) filing

M.F/Formula

C₁₆₅H₂₄₉N₄₉O₃₇S

M.W/Mr.

3543.17

Sequence

One Letter Code: WYKHVASPRYHTVGRAAGLLMGLRRSPYLW
three Letter Code: H-Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp-OH trifluoroacetate salt

Source#

Synthetic

1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function

2. TMEM16F and dynamins control expansive plasma membrane reservoirs

3. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review

4. An interdomain binding site on HIV-1 Nef interacts with PACS-1 and PACS-2 on endosomes to down-regulate MHC-I

5. Spatiotemporal delivery of nanoformulated liraglutide for cardiac regeneration after myocardial infarction

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services

cGMP Peptide Service Peptide Modification Services Peptide Nucleic Acids Synthesis Epitope Mapping Services Peptide Analysis Services Peptide Synthesis Services Peptide CDMO Custom Conjugation Service

Hot Products

Deslorelin Acetate

Deslorelin Acetate is a potent GnRH analog peptide for fertility control research. Order Deslorelin peptide from a professional peptide supplier for veterinary applications.

Thymopentin Acetate

Thymopentin Acetate peptide enhances immune modulation and T-cell function. Purchase Thymopentin research peptide online for immunotherapy and cell biology research.

Glucagon

Glucagon peptide promotes glycogen breakdown and blood sugar regulation. Buy Glucagon research peptide online for metabolic and liver studies.

Buserelin Acetate

Buserelin Acetate is a GnRH agonist peptide regulating reproductive hormones. Buy Buserelin peptide powder online to explore fertility and hormone-dependent tumor research.

Atosiban

Atosiban is a peptide oxytocin receptor antagonist that helps prevent preterm labor. Buy Atosiban peptide for reproductive and uterine contractility research.

Teriparatide Acetate

Teriparatide Acetate is a bone-forming peptide supporting osteoporosis research. Buy Teriparatide peptide online to study bone growth and calcium metabolism.

Carperitide

Carperitide is a human atrial natriuretic peptide analog for heart and kidney research. Buy Carperitide peptide online to study diuretic and cardiovascular effects.

Argipressin

Argipressin peptide regulates water balance and blood pressure in biological systems. Shop pure Argipressin peptide online for cardiovascular and kidney research.

Terlipressin Acetate

Terlipressin Acetate is a synthetic vasopressin analog peptide used for vascular and liver research. Buy Terlipressin peptide powder online from a trusted peptide supplier for professional studies.

DOTA-cyclo(RGDfK) acetate

DOTA-cyclo(RGDfK) acetate is a metal-chelating cyclic RGD peptide used to investigate integrin-binding motifs. Its cyclized structure stabilizes ligand presentation for receptor-targeting studies. Researchers analyze its conformation for high-affinity binding models. The DOTA moiety supports imaging-related biochemical experiments.

About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers