Neuropeptide Y (29-64), amide, human

Neuropeptide Y (29-64), amide, human is a biologically active 36-amino acid peptide.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1545

CAS No:90880-35-6

Synonyms/Alias:Human neuropeptide Y (29-64)

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₈₉H₂₈₅N₅₅O₅₇S
M.W/Mr.
4271.68
Sequence
One Letter Code: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
three Letter Code: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2

Neuropeptide Y (29-64), amide, human is a synthetic peptide fragment derived from the C-terminal region of the human neuropeptide Y (NPY) sequence, specifically encompassing residues 29 through 64 with an amidated C-terminus. As a biologically relevant peptide fragment, it retains key structural motifs essential for receptor interaction and functional activity, making it a valuable tool for probing the role of NPY in diverse neurobiological and physiological processes. The amidation at the C-terminus further enhances its stability and mimics the natural post-translational modification observed in vivo, thereby increasing its utility in experimental systems that seek to recapitulate endogenous peptide signaling. Researchers utilize this fragment to dissect the structure-activity relationships within the NPY family and to elucidate the molecular underpinnings of peptide-receptor interactions in the central and peripheral nervous systems.

Receptor Pharmacology: The C-terminal fragment of neuropeptide Y, particularly in its amidated form, is widely employed in receptor binding assays to investigate the specificity and affinity of NPY receptors, including Y1, Y2, Y4, and Y5 subtypes. By isolating the functional core of the peptide, scientists can determine the minimal sequence required for receptor activation or inhibition, facilitating the identification of critical residues involved in ligand-receptor recognition. Such studies support the development of selective agonists or antagonists and advance understanding of receptor subtype pharmacology.

Signal Transduction Studies: The NPY (29-64), amide fragment serves as a model ligand in studies of G protein-coupled receptor (GPCR) signaling pathways. Its ability to selectively engage NPY receptors allows researchers to monitor downstream effects such as second messenger production, ion channel modulation, and kinase activation. These experimental systems provide insight into the cellular mechanisms by which NPY influences neuronal excitability, synaptic transmission, and neuroendocrine regulation, supporting investigations into the broader physiological roles of the peptide.

Peptide Structure-Activity Relationship (SAR) Analysis: The truncated and amidated form of NPY is a crucial tool for delineating the structural features that govern peptide activity. By comparing the biological effects of full-length NPY with those of the 29-64 fragment, investigators can map functional domains responsible for receptor binding, signal initiation, and specificity. Such SAR studies inform the rational design of peptide analogs with altered potency, selectivity, or metabolic stability, thereby accelerating the development of research probes and next-generation peptide-based tools.

Peptide Synthesis and Analytical Method Development: The availability of a well-defined peptide fragment like NPY (29-64), amide supports the optimization of solid-phase peptide synthesis protocols and purification strategies. It is frequently utilized as a reference standard or calibration compound in chromatographic and mass spectrometric analyses, enabling the validation of analytical methods for peptide quantification, purity assessment, and structural characterization. These capabilities are essential for ensuring reproducibility and accuracy in peptide research workflows.

Neurobiological Research Models: The human NPY (29-64), amide fragment is routinely applied in in vitro and ex vivo experimental systems to model NPY-mediated signaling in neuronal and neuroendocrine tissues. Its use facilitates the study of synaptic plasticity, neurotransmitter release, and peptide-mediated modulation of neuronal circuits. By providing a controllable and reproducible means to activate or inhibit NPY pathways, this peptide fragment enables detailed investigations into the physiological and pathophysiological roles of neuropeptides within the central nervous system and peripheral tissues.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServiceCustom Conjugation ServicePeptide Synthesis ServicesEpitope Mapping ServicesPeptide Modification ServicesPeptide Analysis ServicesPeptide CDMOPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers