CAT# | N10001 |
Sequence | ASATWGAAYPACENNCRKKYDLCIRCQGKWAGKRGKCAAHCIIQKNNCKGKCKKE |
Length | 55 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X06956 | PM_15323554 | Inquiry | ||
X00011 | ACNQR_HUVEC | Inquiry | ||
X20741 | UP_Q86N75 | Inquiry | ||
P6508 | Protein Kinase C (530-558) | Inquiry | ||
X12911 | PM_7038049 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
st-Ht31, a protein kinase A (PKA)-anchoring inhibitor, greatly induces robust cholesterol or phospholipid effl ...
The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
Tertiapin-Q (TPN-Q) is a small compact protein that contains twenty-one amino acids, which derived from bee veno ...