Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GRCVCRKQLLCSYRERRIGDCKIRGVRFPFCCPR |
Activity | Antimicrobial |
Host Chemicals | Oryctolagus cuniculus |
Length | 34 |
SwissProt ID | P07468 |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
2. High fat diet and GLP-1 drugs induce pancreatic injury in mice
4. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.